General description
ZNF318 is a zinc-finger protein that is upregulated during respiratory syncytial virus (RSV) infection in pharyngeal cells.
Rabbit Anti-ZNF318 recognizes mouse, canine, and human ZNF318.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZNF318
Application
Rabbit Anti-ZNF318 can be used for IHC (4-8μg/ml) and western blot (0.5μg/ml) applications.
Biochem/physiol Actions
ZNF318 encodes a nuclear protein with a zinc finger motif of the Cys2-His2 type that is a novel corepressor of androgen receptor (AR).
Sequence
Synthetic peptide located within the following region: SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51202807
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV32523-100UL