General description
Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Comparison of Rat and Human Beta-Amyloid (11-40) sequence
EVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - Rat, MW = 3170.74
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - Human, MW = 3151.7
Product Source: E. coli
Application
Research Category
Neuroscience
Research Sub Category
Neurodegenerative Diseases
Physical form
White lyophilized powder. Resuspend in 1% NH4OH at a concentration of 1 mg/mL. Sonicate for 30 seconds to 1 minute after it has gone into solution. To bring into your solution: After resuspension, add 5x or 10x buffer stock (PBS, TBS) and water to bring to 1x buffer.
Storage and Stability
Maintain lyophilized material at -20°C for up to 12 months after date of receipt. After reconstitution maintain at -20°C to -70°C for up to 2 weeks in undiluted aliquots. Avoid freeze/thaw cycles to avoid aggregation.
Legal Information
CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
biological source: rat. Quality Level: 100. Assay: >. 95%. form: powder. mol wt: Mw 3170.74 . Da. manufacturer/tradename: Chemicon®. . technique(s): cell based assay: suitable. NCBI accession no.: NM_000484.2, NM_201413.1, NM_201414.1. UniProt accession no.: P05067. shipped in: wet ice. Gene Information: mouse ... APP(11820)rat ... APP(54226). Storage Class Code: 11 - Combustible Solids. WGK: WGK 1. Flash Point(F): Not applicable. Flash Point(C): Not applicable.
- UPC:
- 51142515
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AG546