PCR ELISA

General description DCXR is an enzyme that has both diacetyl reductase (EC 1.1.

DECR1 (2,4-dienoyl-CoA reductase 1, mitochondrial) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily. The gene is mapped to human chromosome 8q21.

DECR1 (2,4-dienoyl-CoA reductase 1, mitochondrial) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily. The gene is mapped to human chromosome 8q21.

DECR1 (2,4-dienoyl-CoA reductase 1, mitochondrial) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily. The gene is mapped to human chromosome 8q21.

Immunogen DECR2 (NP_065715, 1 a.a.

Immunogen Synthetic peptide directed towards the C terminal region of human DPCR1 Sequence Synthetic peptide located within the following region: SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG Physical form Purified antibody supplied in

Anti-FAAP100 Fanconi anemia core complex associated protein

Anti-FAAP100 Fanconi anemia core complex associated protein

Anti-FAAP100 Fanconi anemia core complex associated protein

Anti-FAAP100 Fanconi anemia core complex associated protein

The gene FLVCR1 (feline leukemia virus subgroup C cellular receptor 1) is mapped to human chromosome 1q32. The gene encodes two proteins, FLVCR1a (a heme exporter in the plasma membrane) and FLVCR1b (a heme exporter in the mitochondria).

General description The protein encoded by this gene is a member of the folate receptor (FOLR) family. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of