-
Add to Cart The item has been added360773-1AIF Blocking Peptide
Price: $324.72List Price: $360.80Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) To be used in conjunction with Cayman&rsquos AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF. -
Add to Cart The item has been addedSBP4801-0.05MGAKIRIN1 (AB2) BLOCKING PEPTIDE FOR PRS4801
Price: $198.31List Price: $220.34Immunogen 14 amino acids near the center of human Akirin1. Application Used as a blocking peptide in immunoblotting applications. -
Add to Cart The item has been addedSBP4787-0.05MGALDH3A1 BLOCKING PEPTIDE FOR PRS4787
Price: $198.31List Price: $220.34Immunogen 13 amino acids near the carboxy terminus of human Aldh3A1. Application Used as a blocking peptide in immunoblotting applications. -
Add to Cart The item has been addedQBD11305-100MGAMINO-DPEG(R)24-AMIDO-DPEG(R)24-ACID (C005B-432041)
Price: $1,231.84List Price: $1,368.71Features and Benefits Amino-dPEG ®: â‚‚â‚„-amido-dPEG ®: â‚‚â‚„-acid can be used to introduce a hydrophilic dPEG through reaction with either the amine or the carboxyl. Legal Information Products Protected under U. -
Add to Cart The item has been addedQBD11305-1000MGAMINO-DPEG(R)24-AMIDO-DPEG(R)24-ACID (C005B-432042)
Price: $4,048.65List Price: $4,498.50Features and Benefits Amino-dPEG ®: â‚‚â‚„-amido-dPEG ®: â‚‚â‚„-acid can be used to introduce a hydrophilic dPEG through reaction with either the amine or the carboxyl. Legal Information Products Protected under U. -
Add to Cart The item has been added221147-25GAMINOMALONONITRILE P-TOLUENESULFONATE 9 8% (C005B-045498)
Price: $782.12List Price: $869.02Application Aminomalononitrile p -toluenesulfonate was used in the syntheiss of 1-substituted 5-amino-4-cyano-2-hydroxyimidazoles . -
Add to Cart The item has been added221147-5GAMINOMALONONITRILE P-TOLUENESULFONATE 9 8% (C005B-045499)
Price: $212.90List Price: $236.56Application Aminomalononitrile p -toluenesulfonate was used in the syntheiss of 1-substituted 5-amino-4-cyano-2-hydroxyimidazoles . -
Add to Cart The item has been addedSBR00016-1MLAMINOPTERIN READY MADE SOLUTION 50 MG/ML IN DMSO
Price: $903.74List Price: $1,004.16Biochem/physiol Actions Aminopterin is a synthetic derivative of pterin. It is used as a folic acid antagonist. -
Add to Cart The item has been addedA3411-100MGAMINOPTERIN BIOREAGENT SUITABLE FOR CELL CULTURE (C005B-048016)
Price: $1,005.90List Price: $1,117.67Application Aminopterin has been used in the production of anti- neurogranin antibodies. Biochem/physiol Actions Aminopterin is found to inhibit growth, embryogenesis and has toxic effects in mice models. -
Add to Cart The item has been addedA3411-10MGAMINOPTERIN BIOREAGENT SUITABLE FOR CELL CULTURE (C005B-048017)
Price: $198.49List Price: $220.55Application Aminopterin has been used in the production of anti- neurogranin antibodies. Biochem/physiol Actions Aminopterin is found to inhibit growth, embryogenesis and has toxic effects in mice models. -
Add to Cart The item has been addedA3411-25MGAMINOPTERIN BIOREAGENT SUITABLE FOR CELL CULTURE (C005B-048018)
Price: $328.34List Price: $364.83Application Aminopterin has been used in the production of anti- neurogranin antibodies. Biochem/physiol Actions Aminopterin is found to inhibit growth, embryogenesis and has toxic effects in mice models. -
HPA017742-100Anti-DDC dopa decarboxylase (aromatic L-amino acid decarboxy (C003B-335447)
Price: $1,254.10List Price: $1,393.45Anti-DDC dopa decarboxylase (aromatic L-amino acid decarboxy
