-
HPA042199-100UL
Anti-GPSM1 antibody produced in rabbit (C15-1457-111)
Price: $928.29List Price: $1,031.43G-protein-signaling modulator 1 (GPSM1) is also called activator of G protein signalling 3 (AGS3). The GPSM1 gene is mapped to human chromosome 9q34. -
HPA060736-100UL
ANTI-GPSM1 ANTIBODY PRODUCED IN RABBIT (C15-1463-612)
Price: $977.14List Price: $1,085.71Immunogen G protein signaling modulator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA007327-100UL
Anti-GPSM2 antibody produced in rabbit (C15-1446-872)
Price: $879.43List Price: $977.14G-protein signaling modulator 2 (GPSM2) gene encodes a member of a family of proteins that function in the activation of G proteins. It contains 10 leu-gly-asn (LGN) repeats at the N-terminal and four Gαi/o–Loco (GoLoco) motifs at the -
HPA008408-100UL
Anti-GPSM2 antibody produced in rabbit (C15-1447-130)
Price: $879.43List Price: $977.14Immunogen G-protein-signaling modulator 2 recombinant protein epitope signature tag (PrEST) Sequence FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD Application All Prestige Antibodies Powered -
AV45710-100UL
Anti-GPT (AB1) antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human GPT Application Anti-GPT (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml and for immunohistochemistry of -
AV48996-100UL
Anti-GPT2 antibody produced in rabbit (C15-1341-726)
Price: $819.43List Price: $910.48Immunogen Synthetic peptide directed towards the C terminal region of human GPT2 Application Anti-GPT2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
HPA051514-100UL
Anti-GPT2 antibody produced in rabbit (C15-1460-693)
Price: $977.14List Price: $1,085.71Immunogen glutamic pyruvate transaminase (alanine aminotransferase) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
AV41491-100UL
Anti-GPX3 antibody produced in rabbit
Price: $819.43List Price: $910.48Glutathione peroxidase refers to a family of isozymes that protect organisms from oxidative damage by reducing lipid hydroperoxides to their corresponding alcohols. Glutathione peroxidase 3 (GPX3) is an extracellular Gpx isozyme found mainly in -
HPA047224-100UL
Anti-GPX4 antibody produced in rabbit (C15-1459-177)
Price: $928.29List Price: $1,031.43Immunogen glutathione peroxidase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA058546-100UL
Anti-GPX4 antibody produced in rabbit (C15-1462-982)
Price: $928.29List Price: $1,031.43Immunogen glutathione peroxidase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA012316-100UL
Anti-GRAMD1C antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen GRAM domain-containing protein 1C recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA029435-100UL
Anti-GRAMD2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen GRAM domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported