Cell Biology

G-protein-signaling modulator 1 (GPSM1) is also called activator of G protein signalling 3 (AGS3). The GPSM1 gene is mapped to human chromosome 9q34.

Immunogen G protein signaling modulator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

G-protein signaling modulator 2 (GPSM2) gene encodes a member of a family of proteins that function in the activation of G proteins. It contains 10 leu-gly-asn (LGN) repeats at the N-terminal and four G&#945i/o–Loco (GoLoco) motifs at the

Immunogen G-protein-signaling modulator 2 recombinant protein epitope signature tag (PrEST) Sequence FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD Application All Prestige Antibodies Powered

Immunogen Synthetic peptide directed towards the N terminal region of human GPT Application Anti-GPT (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0&#956g/ml and for immunohistochemistry of

Immunogen Synthetic peptide directed towards the C terminal region of human GPT2 Application Anti-GPT2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen glutamic pyruvate transaminase (alanine aminotransferase) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Glutathione peroxidase refers to a family of isozymes that protect organisms from oxidative damage by reducing lipid hydroperoxides to their corresponding alcohols. Glutathione peroxidase 3 (GPX3) is an extracellular Gpx isozyme found mainly in

Immunogen glutathione peroxidase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen glutathione peroxidase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen GRAM domain-containing protein 1C recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen GRAM domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported