-
HPA028707-100UL
Anti-GTF2F1 antibody produced in rabbit (C15-1451-972)
Price: $879.43List Price: $977.14Immunogen general transcription factor IIF, polypeptide 1, 74kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA070752-100UL
Anti-GTF2F1 antibody produced in rabbit (C15-1465-902)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to general transcription factor IIF subunit 1 Sequence SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA006912-100UL
Anti-GTF2F2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Transcription initiation factor IIF subunit β recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA046660-100UL
Anti-GTF2H1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen general transcription factor IIH, polypeptide 1, 62kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA047001-100UL
Anti-GTF2H2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen general transcription factor IIH, polypeptide 2, 44kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
AV31438-100UL
Anti-GTF2H3 antibody produced in rabbit (C15-1340-637)
Price: $898.29List Price: $998.10GTF2H3 belongs to the TFB4 family of transcription factors and forms a part of the TFIIH complex. GTF2H3 regulates nucleotide excision repair and RNA polymerase II-mediated transcription. -
HPA004844-100UL
Anti-GTF2H3 antibody produced in rabbit (C15-1446-292)
Price: $879.43List Price: $977.14Immunogen general transcription factor IIH, polypeptide 3, 34kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA053562-100UL
Anti-GTF2H3 antibody produced in rabbit (C15-1461-377)
Price: $928.29List Price: $1,031.43Immunogen general transcription factor IIH, polypeptide 3, 34kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
AV32598-100UL
Anti-GTF2H4 antibody produced in rabbit (C15-1340-749)
Price: $898.29List Price: $998.10GTF2H4 is a 52kDa transcription factor. Mutations in this gene have been linked to the risk of multiple sclerosis. -
HPA074336-100UL
Anti-GTF2H4 antibody produced in rabbit (C15-1466-537)
Price: $928.29List Price: $1,031.43Immunogen general transcription factor IIH, polypeptide 4, 52kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
AV33735-100UL
Anti-GTF2IRD1 (AB1) antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the C terminal region of human GTF2IRD1 Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Chromatin immunoprecipitation -
HPA044254-100UL
Anti-GTF2IRD1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen GTF2I repeat domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are