-
Add to Cart The item has been addedHPA058631-100ULAnti-GTPBP8 antibody produced in rabbit (C15-1463-017)
Price: $928.29List Price: $1,031.43Immunogen GTP-binding protein 8 (putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA038876-100ULAnti-GTSF1 antibody produced in rabbit (C15-1455-486)
Price: $928.29List Price: $1,031.43Immunogen gametocyte specific factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA038877-100ULAnti-GTSF1 antibody produced in rabbit (C15-1455-487)
Price: $928.29List Price: $1,031.43Immunogen gametocyte specific factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA054694-100ULAnti-GTSF1L antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen gametocyte specific factor 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA005561-100ULAnti-GUCA1A antibody produced in rabbit (C15-1446-395)
Price: $879.43List Price: $977.14Immunogen guanylate cyclase activator 1A (retina) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA075056-100ULANTI-GUCA1A ANTIBODY PRODUCED IN RABBIT (C15-1466-667)
Price: $977.14List Price: $1,085.71Immunogen guanylate cyclase activator 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA055479-100ULAnti-GUCA1B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to guanylate cyclase activator 1B Sequence GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA041597-100ULAnti-GUCA1C antibody produced in rabbit
Price: $928.29List Price: $1,031.43Guanylate cyclase activator 1C (GUCA1C), also known as guanylate cyclase activating protein 3 (GCAP3), is encoded by the gene mapped to human chromosome 3q13.1. -
Add to Cart The item has been addedHPA018215-100ULAnti-GUCA2A antibody produced in rabbit
Price: $879.43List Price: $977.14The gene guanylate cyclase activator 2A (GUCA2A) is mapped to human chromosome 1p35-p34. GUCA2A mRNA is mainly detected in the gastrointestinal tract and kidney. -
Add to Cart The item has been addedA5062-.25MLAnti-Guinea Pig IgG (whole molecule)-Alkaline Phosphatase antibody produced in goat (C15-1315-237)
Price: $207.43List Price: $230.48Immunoglobulin G (IgG) is a glycoprotein antibody that regulates immune responses such as phagocytosis and is also involved in the development of autoimmune diseases . In guinea pig IgG is subdivided into-IgG1 and IgG2. -
Add to Cart The item has been addedA5062-.5MLAnti-Guinea Pig IgG (whole molecule)-Alkaline Phosphatase antibody produced in goat (C15-1315-238)
Price: $310.41List Price: $344.90Immunoglobulin G (IgG) is a glycoprotein antibody that regulates immune responses such as phagocytosis and is also involved in the development of autoimmune diseases . In guinea pig IgG is subdivided into-IgG1 and IgG2. -
Add to Cart The item has been addedA5062-1MLAnti-Guinea Pig IgG (whole molecule)-Alkaline Phosphatase antibody produced in goat (C15-1315-239)
Price: $499.59List Price: $555.10Immunoglobulin G (IgG) is a glycoprotein antibody that regulates immune responses such as phagocytosis and is also involved in the development of autoimmune diseases . In guinea pig IgG is subdivided into-IgG1 and IgG2.
