Cell Biology

HEXIM1 is induced by hexamethylene bis-acetamide. It co-ordinates with 7SK snRNAand subsequently inhibits P-TEFb (CDK9/Cyclin T) and RNA polymerase II.

HEXIM1 (hexamethylene bis-acetamide inducible 1) functions as a homdimer and was first recognized in hexamethylene bisacetamide (HMBA) treated vascular smooth muscle cells. It is primarily known as the inhibitor of positive transcription elongation

The gene HEXIM2 (hexamethylene bisacetamide inducible 2) is mapped to human chromosome 17. The protein has an RNA binding domain, a nuclear localization signal, a PYNT domain and a potential leucine zipper.

Immunogen hexamthylene bis-acetamide inducible 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Specificity Reacts with the Type II isozyme of rat hexokinase (102 kDa). No reactivity with the Type I or Type III isozymes of rat hexokinase by immunoblot or ELISA.

Hairy/enhancer-of-split related with YRPW motif 1 (HEY1, HESR1, HERP2, HRT1, CHF2), a basic helix-loop-helix (bHLH)-type transcription factor/repressor, is a downstream effector of Notch and c-Jun signaling. HEY1/HESR1 is involved in the regulation

Immunogen hairy/enhancer-of-split related with YRPW motif 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen hes-related family bHLH transcription factor with YRPW motif 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Hairy/enhancer-of-split related with YRPW motif-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Recombinant protein corresponding to hes related family bHLH transcription factor with YRPW motif-like Sequence MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII Application All Prestige Antibodies Powered by Atlas Antibodies are

Homogentisate 1,2-dioxygenase (HGD) is 49 kDa protein with N-terminal domain, having a &#946 sandwich structure. HGD is mapped to human chromosome 3q21-23.

Immunogen homogentisate 1,2-dioxygenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in