Cell Biology

Immunogen high mobility group nucleosome binding domain 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen High mobility group protein 2-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen HMG-box containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Hyaluronan mediated motility receptor (HMMR) is also called Receptor for hyaluronan-mediated motility (RHAMM), Intracellular hyaluronic acid-binding protein (IHABP), and CD_antigen 168 (CD168). HMMR is involved in cell motility, and is also linked

Immunogen Heme oxygenase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Heme oxygenase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to HMP19 protein Sequence KAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen HMP19 protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

H6 family homeobox 2 (HMX2) is encoded by the gene mapped to human chromosome 10q26.13.

Immunogen H6 family homeobox 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

HNF1B (hepatocyte nuclear factor 1 &#946), a homeodomain, is an atypical POU (Pit-1, Oct-1, andUnc-86) transcription factor which is associated with the early vertebrate development and embryonic survival. It is expressed in the pancreas, kidney,

HNF4G is a nuclear receptor that regulates hyaluronan synthase 2 (HAS2) and facilitates the metastasis of bladder cancer. Rabbit Anti-HNF4G recognizes chicken, mouse, canine, bovine, human, and rat HNF4G.