Cell Biology

Immunogen heparanase 2 (inactive) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen hemopexin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen hemopexin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen HRAS-like suppressor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

HRAS-like suppressor 2 (HRASLS2) belongs to type II tumor suppressor HREV107 family and is expressed predominantly in trachea, intestine and kidney. It has N-terminal proline-rich region, a lecithin:retinol acyltransferase homology domain (LRAT)

Synoviolin (SYVN1) is an endoplasmic reticulum (ER)-membrane resident E3 ubiquitin ligase. The SYVN1 gene is mapped to human chromosome 11q13.

Heparan sulfate (glucosamine) 3-O-sulfotransferase 5 (HS3ST5) is a 3-OST homologous, type II membrane-bound protein consisting of a transmembrane domain and a functional sulfotransferase domain. It is highly expressed in fetal brain, followed by

Immunogen heparan sulfate (glucosamine) 3-O-sulfotransferase 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen heparan sulfate 6-O-sulfotransferase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to heparan sulfate 6-O-sulfotransferase 3 Sequence QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

The gene HSD17B14 (17-&#946-hydroxysteroid dehydrogenase 14) is mapped to human chromosome 19q13.33.

Immunogen hydroxysteroid (17-beta) dehydrogenase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive