-
Add to Cart The item has been addedHPA063613-100ULAnti-HSF5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen heat shock transcription factor family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA063040-100ULAnti-HSFX2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to heat shock transcription factor family, X-linked 2 Sequence SMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSN Application All Prestige Antibodies -
Add to Cart The item has been addedCA1023-50UGAnti-Hsp90alpha Mouse mAb (EMD-17D7)
Price: $469.38List Price: $521.53Protein G PLUS/protein A purified mouse monoclonal antibody. Recognizes the ~90 kDa Hsp90α protein. -
Add to Cart The item has been addedAV48436-100ULAnti-HSPB6 antibody produced in rabbit (C15-1341-695)
Price: $759.43List Price: $843.81HSPB6 (Hsp20) encodes a heat shock protein that may be involved in the relaxation of smooth muscles. It is known to interact with Bag3. -
Add to Cart The item has been addedHPA044153-100ULAnti-HSPB6 antibody produced in rabbit (C15-1458-049)
Price: $928.29List Price: $1,031.43Immunogen heat shock protein, alpha-crystallin-related, B6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA054811-100ULAnti-HSPB6 antibody produced in rabbit (C15-1461-801)
Price: $928.29List Price: $1,031.43Immunogen heat shock protein, alpha-crystallin-related, B6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAV39602-100ULAnti-HSPBAP1 antibody produced in rabbit
Price: $898.29List Price: $998.10HSPBAP1 codes for a protein that binds to and inhibits the functions of the heat shock protein, hsp27. HSPBAP1 expression has been implicated in intractable epilepsy. -
Add to Cart The item has been addedHPA038755-100ULAnti-HSPE1 antibody produced in rabbit (C15-1455-426)
Price: $928.29List Price: $1,031.43Immunogen heat shock 10kDa protein 1 (chaperonin 10) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA048272-100ULAnti-HSPE1 antibody produced in rabbit (C15-1459-517)
Price: $928.29List Price: $1,031.43Immunogen heat shock 10kDa protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA072690-100ULANTI-HSPG2 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen heparan sulfate proteoglycan 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA077228-100ULANTI-HTD2 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen hydroxyacyl-thioester dehydratase type 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA018073-100ULAnti-HTR1A antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen 5-hydroxytryptamine receptor 1A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
