-
Add to Cart The item has been addedHPA026538-100ULAnti-KYAT3 antibody produced in rabbit (C15-1451-096)
Price: $879.43List Price: $977.14Immunogen kynurenine aminotransferase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA027168-100ULAnti-KYAT3 antibody produced in rabbit (C15-1451-351)
Price: $879.43List Price: $977.14Immunogen kynurenine aminotransferase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAV46036-100ULAnti-KYNU (AB2) antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human KYNU Application Anti-KYNU (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml. Biochem/physiol Actions KYNU gene encodes a -
Add to Cart The item has been addedABT143Anti-L1CAM Antibody (C15-1317-993)
Price: $785.14List Price: $872.38Families of adhesion molecules which share common carbohydrate domains do exist, despite the structural and functional diversity of these glycoproteins. These include the Ca2+-independent neural adhesion molecules (N-CAM), myelin associated -
Add to Cart The item has been addedHPA005830-100ULAnti-L1CAM antibody produced in rabbit
Price: $879.43List Price: $977.14The gene L1CAM (L1 cell adhesion molecule) encodes a member of the immunoglobulin supergene family. The encoded protein contains a cytoplasmic intracellular domain, one single-pass transmembrane region and an extracellular domain containing six -
Add to Cart The item has been addedHPA065409-100ULAnti-L2HGDH antibody produced in rabbit (C15-1464-883)
Price: $928.29List Price: $1,031.43Immunogen L-2-hydroxyglutarate dehydrogenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA069708-100ULAnti-L2HGDH antibody produced in rabbit (C15-1465-732)
Price: $928.29List Price: $1,031.43Immunogen L-2-hydroxyglutarate dehydrogenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA056694-100ULAnti-L3HYPDH antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen L-3-hydroxyproline dehydratase (trans-) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA068051-100ULAnti-L3MBTL1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to l(3)mbt-like 1 (Drosophila) Sequence STVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA044382-100ULAnti-L3MBTL3 antibody produced in rabbit (C15-1458-126)
Price: $928.29List Price: $1,031.43Immunogen l(3)mbt-like 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA053035-100ULAnti-L3MBTL3 antibody produced in rabbit (C15-1461-212)
Price: $928.29List Price: $1,031.43Immunogen l(3)mbt-like 3 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA064194-100ULAnti-L3MBTL4 antibody produced in rabbit (C15-1464-578)
Price: $928.29List Price: $1,031.43Immunogen l(3)mbt-like 4 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
