Cell Biology

Immunogen Synthetic peptide directed towards the C terminal region of human LARP7 Sequence Synthetic peptide located within the following region: HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL Physical form Purified antibody supplied in 1x PBS

La ribonucleoprotein domain family member 7 (LARP7), also known as HDCMA18P or PIP7S, is the member of LARP RNA-binding protein family. The gene coding for this oligopyrimidine-binding protein is mapped near human chromosome 4q25.

Immunogen La ribonucleoprotein domain family, member 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

LARS is the critical cytoplasmic enzyme that charges the tRNA for leucine to become L-leucyl-tRNA, or tRNA(Leu). LARS is thus critical for protein biosynthesis and LARS is up regulated, like many proteins, in cancer.

Immunogen leucyl-tRNA synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen leucyl-tRNA synthetase 2, mitochondrial recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen leucyl-tRNA synthetase 2, mitochondrial recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen leucyl-tRNA synthetase 2, mitochondrial Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Longevity assurance homologue 3 (LASS3) is a testis-specific (dihyrdo)ceramide synthase that acts on a broad range of substrates. LASS3 is known to have two transcriptional variants, comprising of a 384-amino acid protein and a 419-amino acid

LAT (linker for activation of T cells) is a leukocyte type III transmembrane adaptor protein. It is made of 262 amino acids, and has a shorter isoform made of 233 amino acids.

Linker for activation of T-cells family member 2 is a protein encoded by the LAT2 gene in humans. It is a transmembrane adaptor protein and is expressed in various myeloid and lymphoid cells.

The gene LATS1 (large tumor suppressor kinase 1) is mapped to human chromosome 6q25.1.