Cell Biology

Immunogen lipoma HMGIC fusion partner-like 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen lipoma HMGIC fusion partner-like 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase) gene is localized to human chromosome 10. This protein was initially isolated from swine brain.

LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase) gene is localized to human chromosome 10. This protein was initially isolated from swine brain.

Immunogen LIM homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to LIM homeobox 1 Sequence NGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHL Application All Prestige Antibodies Powered by Atlas

Immunogen LIM homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen LIM homeobox 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen LIM homeobox 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Ligand-dependent nuclear receptor-interacting factor 1 (LRIF1), also known as RIF1, Receptor-interacting factor 1, and is encoded by the gene LRIF1/C1orf103/RIF1. The retinoic acid receptors (RARs) are ligand-dependent transcription factors that

Immunogen leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Leukocyte immunoglobulin-like receptor subfamily B member 2 (UniProt Q8N423 also known as CD85 antigen-like family member D, CD85d, Ig-like transcript 4, ILT-4, Leukocyte immunoglobulin-like receptor 2, LIR-2, MIR-10, Monocyte/macrophage