Cell Biology

LMTK2 (lemur tyrosine kinase 2) contains two transmembrane domains at its N-terminus, a kinase domain and a very long C-terminal tail domain with serine/threonine/tyrosine kinase activity. The gene is mapped to human chromosome 7q21.

Immunogen lemur tyrosine kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

LMX-1 is a transcription factor that belongs to the LIM-homeodomain (LIM-HD) transcription factor family. It is induced within the ventral midbrain as a response to early signaling.

Immunogen LIM homeobox transcription factor 1, beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Lnk is an SH2B3 multidomain adaptor protein that is primarily expressed in lymphocytes. It contains the characteristic pleckstrin homology (PH) src homology 2 (SH2) dimerization and proline-rich domains.

The gene KIAA1715 is also referred to as LNP1 (Lunapark1) and encodes a member of the conserved lunapark protein family. The protein is characterized by two transmembrane domains and a zinc finger motif.

LNX1 (ligand of numb-protein X 1) is the PDZ (PSD95, Dlg1, and zo-1) domain-containing member of the RING (really interesting new gene) finger-type E3 ubiquitin ligase family. It participates in tumorigenesis.

Immunogen ligand of numb-protein X 1, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen ligand of numb-protein X 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Lysophosphatidic acid receptor 5 (LPA receptor 5), also known as GPR92, is a G12/13 and Gq coupled receptor that mediates the signaling of LPA. Ligand binding to LPA receptor 5 may increase intracellular levels of cAMP and calcium, resulting in the

Immunogen synthetic peptide corresponding to amino acids 328-344 of human EDG-2/LPA 1 . Application Anti-LPA 1 , C-Terminal antibody produced in rabbit is suitable for western blotting at a working dilution of 1:1000 using rat brain microsomal

Immunogen Recombinant protein corresponding to lysophosphatidic acid receptor 4 Sequence KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein