-
HPA010657-100UL
Anti-LMTK2 antibody produced in rabbit (C15-1447-422)
Price: $879.43List Price: $977.14LMTK2 (lemur tyrosine kinase 2) contains two transmembrane domains at its N-terminus, a kinase domain and a very long C-terminal tail domain with serine/threonine/tyrosine kinase activity. The gene is mapped to human chromosome 7q21. -
HPA041836-100UL
Anti-LMTK2 antibody produced in rabbit (C15-1456-914)
Price: $928.29List Price: $1,031.43Immunogen lemur tyrosine kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
AB10533
Anti-LMX-1 Antibody (C15-1315-657)
Price: $874.29List Price: $971.43LMX-1 is a transcription factor that belongs to the LIM-homeodomain (LIM-HD) transcription factor family. It is induced within the ventral midbrain as a response to early signaling. -
HPA073716-100UL
Anti-LMX1B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen LIM homeobox transcription factor 1, beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
ABT108
Anti-Lnk/SH2B adapter protein 3 Antibody (C15-1317-955)
Price: $804.00List Price: $893.33Lnk is an SH2B3 multidomain adaptor protein that is primarily expressed in lymphocytes. It contains the characteristic pleckstrin homology (PH) src homology 2 (SH2) dimerization and proline-rich domains. -
HPA014205-100UL
Anti-LNPK antibody produced in rabbit
Price: $879.43List Price: $977.14The gene KIAA1715 is also referred to as LNP1 (Lunapark1) and encodes a member of the conserved lunapark protein family. The protein is characterized by two transmembrane domains and a zinc finger motif. -
HPA002235-100UL
Anti-LNX1 antibody produced in rabbit (C15-1445-555)
Price: $879.43List Price: $977.14LNX1 (ligand of numb-protein X 1) is the PDZ (PSD95, Dlg1, and zo-1) domain-containing member of the RING (really interesting new gene) finger-type E3 ubiquitin ligase family. It participates in tumorigenesis. -
HPA071091-100UL
Anti-LNX1 antibody produced in rabbit (C15-1465-966)
Price: $928.29List Price: $1,031.43Immunogen ligand of numb-protein X 1, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA040698-100UL
Anti-LNX2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ligand of numb-protein X 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
ABT114
Anti-LPA receptor 5 Antibody (GPR92) (C15-1317-959)
Price: $804.00List Price: $893.33Lysophosphatidic acid receptor 5 (LPA receptor 5), also known as GPR92, is a G12/13 and Gq coupled receptor that mediates the signaling of LPA. Ligand binding to LPA receptor 5 may increase intracellular levels of cAMP and calcium, resulting in the -
E5017-.1MG
Anti-LPA1, C-Terminal antibody produced in rabbit
Price: $1,928.57List Price: $2,142.86Immunogen synthetic peptide corresponding to amino acids 328-344 of human EDG-2/LPA 1 . Application Anti-LPA 1 , C-Terminal antibody produced in rabbit is suitable for western blotting at a working dilution of 1:1000 using rat brain microsomal -
HPA046563-100UL
Anti-LPAR4 antibody produced in rabbit (C15-1458-892)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to lysophosphatidic acid receptor 4 Sequence KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein