-
HPA064002-100UL
Anti-LRP11 antibody produced in rabbit (C15-1464-541)
Price: $928.29List Price: $1,031.43Immunogen low density lipoprotein receptor-related protein 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA017245-100UL
Anti-LRP12 antibody produced in rabbit
Price: $879.43List Price: $977.14LRP12 (low density lipoprotein receptor-related protein 12) is a novel putative transmembrane receptor protein located on human chromosome 8, band q22.2-23. -
HPA069094-100UL
Anti-LRP1B antibody produced in rabbit (C15-1465-607)
Price: $928.29List Price: $1,031.43Immunogen low density lipoprotein receptor-related protein 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA074788-100UL
Anti-LRP1B antibody produced in rabbit (C15-1466-615)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to low density lipoprotein receptor-related protein 1B. Sequence IANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQANSGLICPEF Application All Prestige Antibodies Powered by Atlas -
HPA005980-100UL
Anti-LRP2 antibody produced in rabbit (C15-1446-533)
Price: $879.43List Price: $977.14Immunogen Low-density lipoprotein receptor-related protein 2 precursor recombinant protein epitope signature tag (PrEST) Application Anti-LRP2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas -
HPA064792-100UL
Anti-LRP2 antibody produced in rabbit (C15-1464-732)
Price: $928.29List Price: $1,031.43Immunogen low density lipoprotein receptor-related protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA036664-100UL
Anti-LRP2BP antibody produced in rabbit (C15-1454-471)
Price: $928.29List Price: $1,031.43Immunogen LRP2 binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA036665-100UL
Anti-LRP2BP antibody produced in rabbit (C15-1454-472)
Price: $928.29List Price: $1,031.43Immunogen LRP2 binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA041658-100UL
ANTI-LRP3 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen LDL receptor related protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA011934-100UL
Anti-LRP4 antibody produced in rabbit (C15-1447-683)
Price: $879.43List Price: $977.14Immunogen Low-density lipoprotein receptor-related protein 4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA012300-100UL
Anti-LRP4 antibody produced in rabbit (C15-1447-758)
Price: $879.43List Price: $977.14Immunogen Low-density lipoprotein receptor-related protein 4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA030505-100UL
Anti-LRP5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen low density lipoprotein receptor-related protein 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive