Cell Biology

Immunogen leucine rich repeat containing 43 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen leucine rich repeat containing 43 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene LRRC45 (leucine rich repeat containing 45) encodes a 72kDa protein that contains several N-terminal leucine-rich repeat (LRR) domains and a long coiled-coil domain at the C terminus. It is localized at the proximal ends of the mother and

The gene LRRC45 (leucine rich repeat containing 45) encodes a 72kDa protein that contains several N-terminal leucine-rich repeat (LRR) domains and a long coiled-coil domain at the C terminus. It is localized at the proximal ends of the mother and

The gene LRRC45 (leucine rich repeat containing 45) encodes a 72kDa protein that contains several N-terminal leucine-rich repeat (LRR) domains and a long coiled-coil domain at the C terminus. It is localized at the proximal ends of the mother and

LRRC46 (leucine rich repeat containing 46) is classified as a differentially expressed gene-probes (DEGs). Its higher expressions have been observed in estrogen receptor positive breast cancer tumors.

Immunogen Leucine-rich repeat-containing protein 47 recombinant protein epitope signature tag (PrEST) Sequence PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEK Application

Immunogen Leucine-rich repeat-containing protein 47 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen leucine rich repeat containing 49 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen leucine rich repeat containing 4B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen leucine rich repeat containing 4C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen leucine rich repeat containing 4C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization