-
HPA036534-100ULImmunogen Recombinant protein corresponding to septin 8. Sequence NAFNRRKAAVEALQSQALHATSQQPLRKDKDKKNRSDIGAHQPGMSLSSSKVMMTKASVEPLNCSSWWPAIQCCSCLVRDATWREGFL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated
-
HPA040755-100UL
Sigma-Aldrich
Anti-AC004381.6 antibody produced in rabbit (C15-1456-339)
Price: $928.29List Price: $1,031.43Immunogen Putative RNA exonuclease NEF-sp recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040868-100UL
Sigma-Aldrich
Anti-AC004381.6 antibody produced in rabbit (C15-1456-404)
Price: $928.29List Price: $1,031.43Immunogen Putative RNA exonuclease NEF-sp recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA007162-100ULImmunogen acyl-CoA synthetase long-chain family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
AV42553-100UL
Sigma-Aldrich
Anti-AKR1B10 antibody produced in rabbit (C15-1341-407)
Price: $759.43List Price: $843.81Aldo-keto reductase family 1B10 (AKR1B10) exhibits restricted lipid substrate specificity including farnesal, geranylgeranial, retinal and carbonyls wherein metabolizing these lipid substrates has a crucial role in promoting carcinogenesis. -
HPA020280-100UL
Sigma-Aldrich
Anti-AKR1B10 antibody produced in rabbit (C15-1449-560)
Price: $879.43List Price: $977.14Aldo-keto reductase family 1, member B10 (AKR1B10) belongs to the aldo-keto reductase (AKR) superfamily and the gene encoding it is localized on human chromosome 7q33.1. -
HPA073633-100UL
Sigma-Aldrich
Anti-AKR1B10 antibody produced in rabbit (C15-1466-411)
Price: $928.29List Price: $1,031.43Immunogen aldo-keto reductase family 1, member B10 (aldose reductase) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA000817-100ULImmunogen Amnionless protein precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA036136-100UL
Sigma-Aldrich
Anti-AMTN antibody produced in rabbit (C15-1454-191)
Price: $928.29List Price: $1,031.43Immunogen amelotin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA036137-100UL
Sigma-Aldrich
Anti-AMTN antibody produced in rabbit (C15-1454-192)
Price: $928.29List Price: $1,031.43Immunogen amelotin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA044547-100ULImmunogen anaphase promoting complex subunit 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA064930-100ULImmunogen aprataxin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The