Blocking Reagents

Application The Blocking Reagent is used to decrease the background in nonradioactive filter hybridization and the detection of nucleic acid hybrids. It has also been used as a blocking agent in immunohistochemistry.

Blocking reagent is used for blocking of nonspecific binding sites in ELISA procedures. Application For research use only.

The Sigma CRISPR-LENTI HUMAN EMX1 POSITIVE CONTROL TRANSDUCTION PARTICLES are a critical positive control to monitor transduction efficiency for lenti CRISPRs. This control is produced from the sequence-verified CRISPR lentiviral plasmid targeting

Application Prediluted for use in Immunohistochemical staining procedures. For example: Blocking Reagent Primary Antibody or Negative Control Reagent Biotinylated Secondary Antibody Streptavidin-Enzyme Conjugate Chromogen Counterstain For best

Application For use in western blots as a blocking agent. Quality Routinely evaluated by western blot Physical form non-fat dry milk fortified with vitamin A palmitate and vitamin D2, containing no preservatives Storage and Stability 2 years at

Immunogen Recombinant protein corresponding to reelin Sequence TFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRFSYSDPSIIVLYAKNNSADWIQLEKIRAPSNVSTIIHILYLPEDAKGENVQFQWKQENLRVGEVYE Epitope Binds to an epitope located within the peptide sequence SADWIQLEKIRAPSN as

PrEST Antigen SOCS5 suppressor of cytokine signaling 5, 100u