-
Add to Cart The item has been addedCLLS1014-1SETA549 Cells HIF1A -/-/-
Price: $7,236.26List Price: $8,040.29A549 Cells HIF1A -/-/- are lung carcinoma, epithelial cells, from a human caucasian male (aged 58 years), with a ZFN knock out modification. This product corresponds to ATCC Cat. -
Add to Cart The item has been addedHPA075570-100ULAnti-ACAP1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 Sequence QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedHPA011861-100ULAnti-ACBD5 antibody produced in rabbit (C15-1447-653)
Price: $879.43List Price: $977.14Immunogen Acyl-CoA-binding domain-containing protein 5 recombinant protein epitope signature tag (PrEST) Application Anti-ACBD5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . -
Add to Cart The item has been addedHPA012145-100ULAnti-ACBD5 antibody produced in rabbit (C15-1447-746)
Price: $879.43List Price: $977.14Immunogen Acyl-CoA-binding domain-containing protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA046291-100ULAnti-ACSM1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen acyl-CoA synthetase medium-chain family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA041013-100ULAnti-ACSM3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Acyl-CoA synthetase medium chain family member 3 (ACSM3), also known as SAH (spontaneously hypertensive rat-clone A-hypertension–associated), is encoded by the gene mapped to human chromosome 16p13.11. -
Add to Cart The item has been addedHPA049895-100ULAnti-ACSM4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen acyl-CoA synthetase medium-chain family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA041435-100ULAnti-ACSM5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen acyl-CoA synthetase medium-chain family member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedCBL171-IAnti-Actin, smooth muscle Antibody, clone ASM-1/1A4
Price: $918.86List Price: $1,020.95Actin, aortic smooth muscle (UniProt P62736 also known as Alpha-actin-2, Cell growth-inhibiting gene 46 protein) is encoded by the ACTA2 (also known as AAT6, ACTSA, ACTVS, GIG46, MYMY5) gene (Gene ID 59) in human. Actins are globular -
Add to Cart The item has been addedHPA006035-100ULAnti-ACTN1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen α-Actinin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA036174-100ULAnti-ACY1 antibody produced in rabbit (C15-1454-217)
Price: $928.29List Price: $1,031.43Immunogen aminoacylase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA036175-100ULAnti-ACY1 antibody produced in rabbit (C15-1454-218)
Price: $928.29List Price: $1,031.43Immunogen aminoacylase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
