-
Add to Cart The item has been addedB9879-1KGBES (C15-1200-065)
Price: $1,125.77List Price: $1,250.86N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid, known as BES, is a zwitterionic buffer and a valuable secondary standard in biochemical research. BES, a sulfonic acid-containing cross-linking agent, induces cross-linking between sulfonated -
Add to Cart The item has been addedB9879-250GBES (C15-1200-066)
Price: $417.01List Price: $463.35N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid, known as BES, is a zwitterionic buffer and a valuable secondary standard in biochemical research. BES, a sulfonic acid-containing cross-linking agent, induces cross-linking between sulfonated -
Add to Cart The item has been addedB9879-25GBES (C15-1200-067)
Price: $167.36List Price: $185.95N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid, known as BES, is a zwitterionic buffer and a valuable secondary standard in biochemical research. BES, a sulfonic acid-containing cross-linking agent, induces cross-linking between sulfonated -
Add to Cart The item has been addedAG970-1MGbeta Amyloid 1-42, abeta, ultra pure, NaOH, recombinant human (C15-1318-357)
Price: $1,078.29List Price: $1,198.10Beta Amyloid (1-42), ultra pure, NaOH MOL. WT. -
Add to Cart The item has been addedAG970-500UGbeta Amyloid 1-42, abeta, ultra pure, NaOH, recombinant human (C15-1318-358)
Price: $780.00List Price: $866.67Beta Amyloid (1-42), ultra pure, NaOH MOL. WT. -
Add to Cart The item has been addedAG546beta amyloid 11-40, rat and mouse (C15-1318-332)
Price: $3,675.82List Price: $4,084.25Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val Comparison of Rat and Human Beta-Amyloid (11-40) sequence EVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - Rat, MW = 3170.74 -
Add to Cart The item has been added353562-5Gbeta-Alanine tert-butyl ester hydrochloride (5G)
Price: $256.41List Price: $284.90Synonyms: ß-Ala-OtBu·HCl Purity Limit: &ge 99% (HPLC) CAS No.: 58620-93-2 Molecular Formula: C7H15NO2·HCl Molecular Weight: 181. -
Add to Cart The item has been addedB75506-100Gbeta-Bromophenetole
Price: $540.69List Price: $600.76beta-Bromophenetole -
Add to Cart The item has been added157449-5Gbeta-Bromostyrene
Price: $153.00List Price: $170.00β-Bromostyrene is an α,β-unsaturated aromatic halide. It can be synthesized by catalytic Hunsdiecker reaction (CHR) of cinnamic acid. -
Add to Cart The item has been added361132-250MGbeta-Cyano-L-alanine (250MG)
Price: $326.26List Price: $362.52Synonyms: ß-Cyano-L-Ala-OH3-Cyano-L-alanine Purity Limit: &ge 98% (TLC) CAS No.: 6232-19-5 Molecular Formula: C4H6N2O2 Molecular Weight: 114.1 MDL No.: MFCD00021722 Appearance: White to off-white powder Storage Temperature: Store at 0-8 °C -
Add to Cart The item has been added180076-5Gbeta-Methylphenethylamine
Price: $258.54List Price: $287.26β-Methylphenethylamine is considered to be a positional isomer of amphetamine . Application β-Methylphenethylamine was used for molecular imprinting and to study the space filling models depicting minimized structures for each enantiomer . -
