-
Add to Cart The item has been addedHPA047039-100ULAnti-RGL2 antibody produced in rabbit (C15-1459-103)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ral guanine nucleotide dissociation stimulator like 2 Sequence FDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWA Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA053444-100ULAnti-RGL2 antibody produced in rabbit (C15-1461-339)
Price: $928.29List Price: $1,031.43Immunogen ral guanine nucleotide dissociation stimulator-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA035979-100ULAnti-RGL4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ral guanine nucleotide dissociation stimulator-like 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA044222-100ULAnti-RGMA antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen repulsive guidance molecule family member a Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA029102-100ULAnti-RGN antibody produced in rabbit (C15-1452-132)
Price: $879.43List Price: $977.14Immunogen regucalcin (senescence marker protein-30) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA029103-100ULAnti-RGN antibody produced in rabbit (C15-1452-133)
Price: $879.43List Price: $977.14Regucalcin protein 30 (SMP-30), is a calcium binding protein. RGN is mapped to human chromosome X and has seven exons. -
Add to Cart The item has been addedHPA029104-100ULANTI-RGN ANTIBODY PRODUCED IN RABBIT (C15-1452-134)
Price: $977.14List Price: $1,085.71Immunogen regucalcin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA020414-100ULAnti-RGP1 antibody produced in rabbit (C15-1449-594)
Price: $879.43List Price: $977.14Retrograde Golgi transport protein RGP1 homolog (RGP1) is expressed in dendritic cells, CD56 + natural killer cells and CD19 + B cells. It is expressed in the cytoplasm. -
Add to Cart The item has been addedHPA021085-100ULAnti-RGP1 antibody produced in rabbit (C15-1449-751)
Price: $879.43List Price: $977.14The gene RGP1 (RAB6A-GEF complex partner protein 2) is mapped to human chromosome 9p13.3. -
Add to Cart The item has been addedHPA049497-100ULAnti-RGPD1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen RANBP2-like and GRIP domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA045704-100ULAnti-RGPD5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen RANBP2-like and GRIP domain containing 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA074572-100ULANTI-RGS1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen regulator of G protein signaling 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
