-
HPA041330-100UL
Anti-RNF40 antibody produced in rabbit (C15-1456-638)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 40 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA054227-100UL
Anti-RNF40 antibody produced in rabbit (C15-1461-613)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 40, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA016812-100UL
Anti-RNF41 antibody produced in rabbit
Price: $879.43List Price: $977.14RNF41 (Ring finger protein 41) is an E3 ubiquitin ligase consisting of RING finger domain including ErbB3 and Parkin. Immunogen ring finger protein 41, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA008079-100UL
Anti-RNF43 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen RING finger protein 43 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA065032-100UL
Anti-RNF5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 5, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA039223-100UL
Anti-RNH1 antibody produced in rabbit (C15-1455-627)
Price: $928.29List Price: $1,031.43Immunogen ribonuclease/angiogenin inhibitor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA040781-100UL
Anti-RNH1 antibody produced in rabbit (C15-1456-357)
Price: $928.29List Price: $1,031.43Immunogen ribonuclease/angiogenin inhibitor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA052968-100UL
Anti-ROBO1 antibody produced in rabbit (C15-1461-194)
Price: $928.29List Price: $1,031.43Immunogen roundabout guidance receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA074461-100UL
Anti-ROBO1 antibody produced in rabbit (C15-1466-561)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to roundabout guidance receptor 1 Sequence PNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGD Application All Prestige Antibodies Powered by -
HPA071053-100UL
ANTI-ROBO3 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen roundabout guidance receptor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA065212-100UL
Anti-ROBO4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen roundabout guidance receptor 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA041000-100UL
Anti-ROGDI antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen rogdi homolog ( Drosophila ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are