-
HPA003403-100UL
Anti-RPL12 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen 60S ribosomal protein L12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA055259-100UL
Anti-RPL18A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L18a recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA043014-100UL
Anti-RPL19 antibody produced in rabbit (C15-1457-477)
Price: $928.29List Price: $1,031.43Ribosomal protein L19 (RPL19) is a member of L19E super-family of proteins and is a component of the ribosomal large 60S subunit. The gene is located on human chromosome 17q12. -
HPA051987-100UL
Anti-RPL19 antibody produced in rabbit (C15-1460-864)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA047252-100UL
Anti-RPL21 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L21 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA069064-100UL
Anti-RPL29 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L29 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA006047-100UL
Anti-RPL35 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen 60S ribosomal protein L35 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA052543-100UL
Anti-RPL38 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L38 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA053169-100UL
Anti-RPL41 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L41 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA043717-100UL
Anti-RPL5 antibody produced in rabbit (C15-1457-840)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA054444-100UL
Anti-RPL5 antibody produced in rabbit (C15-1461-682)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ribosomal protein L5 Sequence RKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAE Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA060903-100UL
Anti-RPL6 antibody produced in rabbit (C15-1463-647)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ribosomal protein L6 Sequence NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas