-
HPA068418-100UL
Anti-RPL6 antibody produced in rabbit (C15-1465-478)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA058373-100UL
Anti-RPL7 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA046794-100UL
Anti-RPL7A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L7a recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA046049-100UL
ANTI-RPL7L1 ANTIBODY PRODUCED IN RABBIT (C15-1458-708)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L7-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA050478-100UL
Anti-RPL7L1 antibody produced in rabbit (C15-1460-312)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L7-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA045095-100UL
Anti-RPL8 antibody produced in rabbit (C15-1458-405)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA050165-100UL
Anti-RPL8 antibody produced in rabbit (C15-1460-208)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein L8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA003512-100UL
Anti-RPLP0 antibody produced in rabbit (C15-1445-986)
Price: $879.43List Price: $977.14Immunogen 60S acidic ribosomal protein P0 recombinant protein epitope signature tag (PrEST) Application Anti-RPLP0 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody -
HPA073501-100UL
ANTI-RPLP0 ANTIBODY PRODUCED IN RABBIT (C15-1466-389)
Price: $977.14List Price: $1,085.71Immunogen ribosomal protein lateral stalk subunit P0 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA050398-100UL
Anti-RPP38 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ribonuclease P/MRP subunit p38 Sequence TDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFK Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA040602-100UL
Anti-RPRD1A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen regulation of nuclear pre-mRNA domain containing 1A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA066290-100UL
Anti-RPRD1B antibody produced in rabbit (C15-1465-058)
Price: $928.29List Price: $1,031.43Immunogen regulation of nuclear pre-mRNA domain containing 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive