Immunomodulating drugs

Special AT-rich sequence-binding protein 2 (SATB2) contains 2 CUT DNA-binding domains and one homeobox DNA binding domain belonging to the CUT homeobox family. SATB2 binds to DNA at the nuclear matri or scaffold-associated regions.

SATB2 (SATB homeobox 2) is an AT rich DNA-binding protein. It is a homologue of SATB1 protein.

Immunogen SATB homeobox 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Synthetic peptide directed towards the N terminal region of human SBDS Biochem/physiol Actions SBDS is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA

Immunogen Shwachman-Bodian-Diamond syndrome recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to SET binding factor 1 Sequence CYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen SET binding factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen strawberry notch homolog 1 ( Drosophila ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen suprabasin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen suprabasin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen RPE-spondin Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Synthetic peptide directed towards the N terminal region of human SBZF3 Biochem/physiol Actions SBZF3 or ZNF695 is a transcription factor characterized by the presence of Krüppel-associated boxes or KRAB domain. Zinc finger proteins have