Immunomodulating drugs

SEC31 homolog A (SEC31A) gene codes for a protein that is localized to vesicles present throughout the cytoplasm. This protein is ubiquitously expressed.

Immunogen SEC31 homolog B ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

SEC31 homolog B, COPII coat complex component (SEC31B), also known as SEC31-like 2, is encoded by the gene spanning 33,187bp with 29 exons. It is mapped to human chromosome 10q24.

Immunogen SECIS binding protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen SECIS binding protein 2-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen selenoprotein V Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to selectin L. Sequence MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

SERPINA1 (serpin peptidase inhibitor, clade A, member 1), also called &#945 1 -antitrypsin, is an acute-phase glycoprotein, which belongs to the serpin superfamily. It is predominantly found in the plasma, and is secreted by hepatocytes.

Immunogen &#945-1-antitrypsin precursor recombinant protein epitope signature tag (PrEST) Sequence

Immunogen serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

The &#9451-antichymotrypsin (ACT) protein has a molar mass of 55-66kDa. It has a serpin structure with three &#946 sheets, 8 &#945 helices and a reactive centre loop containing the active site.