Immunomodulating drugs

Immunogen surfactant protein B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Pulmonary surfactant is a mixture of phospholipids and protein, which is surface-active and secreted by type II epithelial cells into the alveolar space. There are four proteins present in the surfactant namely, SP (surfactant protein)-A, SP-B,

Surfactant protein D (SFTPD) is expressed majorly by alveolar type II cells of the lung, epithelial surfaces, amniotic fluid and serum. The gene is located on human chromosome 10q22.

Immunogen surfactant protein D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Beta-sarcoglycan recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen &#947-Sarcoglycan recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Zeta-sarcoglycan recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

SH3-domain GRB2-like (endophilin) interacting protein 1 (SGIP1) is expressed in the brain. It is rich in proline and highly conserved between species.

Immunogen Immunogen Sequence: GI # 25168263 , sequence 211-431 Recombinant serum/glucocorticoid regulated kinase Physical form Solution in phosphate buffered saline containing 0.02% sodium azide.

Immunogen Recombinant protein corresponding to shugoshin 1 Sequence DFETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANRRKSKRMSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen shugoshin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen shugoshin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most