-
Add to Cart The item has been addedAV32390-100ULAnti-SIRT5 antibody produced in rabbit (C15-1340-725)
Price: $898.29List Price: $998.10SIRT5 (Sirtuin 5) is a mitochondrial matrix protein belonging to the class III of the sirtuin family. It is localized inside the mitochondria and within the cytosol and nucleus. -
Add to Cart The item has been addedHPA021798-100ULAnti-SIRT5 antibody produced in rabbit (C15-1449-995)
Price: $879.43List Price: $977.14SIRT5 (Sirtuin 5) is a mitochondrial matrix protein belonging to the class III of the sirtuin family. It is localized inside the mitochondria and within the cytosol and nucleus. -
Add to Cart The item has been addedHPA022002-100ULAnti-SIRT5 antibody produced in rabbit (C15-1450-047)
Price: $879.43List Price: $977.14SIRT5 (Sirtuin 5) is a mitochondrial matrix protein belonging to the class III of the sirtuin family. It is localized inside the mitochondria and within the cytosol and nucleus. -
Add to Cart The item has been addedHPA022992-100ULAnti-SIRT5 antibody produced in rabbit (C15-1450-203)
Price: $879.43List Price: $977.14The gene SIRT5 (sirtuin 5) is mapped to human chromosome 6p23. It is mainly expressed in brain, testis, heart muscle cells, and lymphoblasts. -
Add to Cart The item has been addedABE103Anti-SIRT7 Antibody (C15-1316-845)
Price: $828.00List Price: $920.00The silent information regulator (SIR) genes (sirtuins) are a highly conserved family of proteins, which contain one or more sirtuins present in various species from bacteria to mammals. There are seven sirtuin genes that encode seven sirtuin -
Add to Cart The item has been addedHPA027284-100ULANTI-SIRT7 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen sirtuin 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA065398-100ULAnti-SIVA1 antibody produced in rabbit (C15-1464-881)
Price: $928.29List Price: $1,031.43Immunogen SIVA1, apoptosis-inducing factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA066693-100ULAnti-SIVA1 antibody produced in rabbit (C15-1465-122)
Price: $928.29List Price: $1,031.43Immunogen SIVA1, apoptosis-inducing factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedABE1070Anti-SKI Antibody (C15-1316-856)
Price: $896.57List Price: $996.19Ski oncogene (SKI) is also called Proto-oncogene c-Ski. Ski acts as a repressor of TGF-beta signaling. -
Add to Cart The item has been addedAV32371-100ULAnti-SKIL antibody produced in rabbit (C15-1340-720)
Price: $759.43List Price: $843.81SKIL forms a part of the SMAD pathway that regulates TGF-β mediated cell growth and differentiation. Rabbit Anti-SKIL antibody recognizes canine, human, mouse, rat, and bovine TGF-β. -
Add to Cart The item has been addedHPA008472-100ULAnti-SKIL antibody produced in rabbit (C15-1447-152)
Price: $879.43List Price: $977.14Immunogen SKI-like proto-oncogene Recombinant Protein Epitope Signature Tag (PrEST) Sequence SPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQ Application All -
Add to Cart The item has been addedHPA014233-100ULANTI-SKIL ANTIBODY PRODUCED IN RABBIT (C15-1448-087)
Price: $977.14List Price: $1,085.71Immunogen SKI like proto-oncogene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
