Immunomodulating drugs

Metalloreductase STEAP4 (STEAP4), also known as Dudulin-4, Six-transmembrane epithelial antigen of prostate 4, Tumor necrosis factor-alpha-induced adipose related protein, and encoded by the gene name STEAP4 and TIARP, is a metalloreductase that

Immunogen STEAP4 metalloreductase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen STEAP family member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen SCL/TAL1 interrupting locus Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Stromal interaction molecule 2 (STIM2) plays an important role in mediating store-operated Ca2+ entry (SOCE), a Ca2+ influx following depletion of intracellular Ca2+ stores. It inhibits STIM1-mediated store-operated Ca++ entry however, STIM2 can

Stimulated by retinoic acid gene 8 protein (UniProt P70278) is encoded by the Stra8 gene (Gene ID 20899) in murine species. Stra8 is an early retinoic acid (RA) responsive gene that encodes a cytoplasmic protein expressed exclusively in gonads,

Immunogen STE20-related kinase adaptor alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to stereocilin Sequence LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen syntaxin 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen syntaxin 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Syntaxin-4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Syntaxin-binding protein 1 (STXBP1) belongs to the Sec1/Munc-18 (SM) family of proteins. It is an intracellular protein present in presynaptic terminals.