Immunomodulating drugs

Immunogen Zinc finger protein 396 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

ZNF397 is a centromeric zinc finger protein that has a SCAN domain and functions as a transcriptional regulator. It has been classified as an interphase to early prophase-specific protein in mammals.

Zinc finger protein 397 (ZNF397) belongs to the Cys2His2 group of the zinc-finger superfamily. It possesses a leucine-rich SCAN domain and nine Cys2His2 zinc fingers.

Immunogen zinc finger protein 398 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to zinc finger protein 404 Sequence VSLDFNFTTESNKLSSEKRNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen zinc finger protein 407 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen zinc finger protein 407 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Zinc finger protein 408 (ZNF408) is a transcription factor consisting of 720 amino acids. It belongs to the C2H2 zinc finger proteins family.

Immunogen zinc finger protein 41 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen zinc finger protein 414 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

ZNF415 (zinc finger protein 415) belongs to zinc finger protein family, which makes up the largest family of transcription factors in human. Alternative splicing of this gene produces five different isoforms, named ZNF415-1 to ZNF415-5.

Immunogen zinc finger protein 416 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the