-
Add to Cart The item has been addedHPA045439-100ULAnti-ZNF560 antibody produced in rabbit (C15-1458-513)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 560 Sequence KDLLSLYNKTSTIRKVSVFSKHGKSFRLILNVQVQRKCTQDKSFEGTDYGKAFIYQSYLEAHR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA063209-100ULAnti-ZNF560 antibody produced in rabbit (C15-1464-307)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 560 Sequence ISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA074438-100ULANTI-ZNF560 ANTIBODY PRODUCED IN RABBIT (C15-1466-557)
Price: $977.14List Price: $1,085.71Immunogen zinc finger protein 560 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA055332-100ULAnti-ZNF561 antibody produced in rabbit (C15-1461-981)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 561 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA062397-100ULAnti-ZNF561 antibody produced in rabbit (C15-1464-065)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 561 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA042136-100ULAnti-ZNF563 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 563 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA043998-100ULAnti-ZNF564 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 564 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA044123-100ULAnti-ZNF565 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 565 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA023456-100ULAnti-ZNF566 antibody produced in rabbit
Price: $879.43List Price: $977.14The zinc finger proteins (ZNFs) are made up of anti-parallel hairpin motif. These proteins contain an α-helix, two β-strands and a hairpin structure. -
Add to Cart The item has been addedHPA023937-100ULAnti-ZNF567 antibody produced in rabbit
Price: $879.43List Price: $977.14ZNF567 (zinc finger protein 567) is a KRAB (Krüppel-associated box)-domain containing zinc finger protein. Immunogen Zinc finger protein 567 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA024541-100ULANTI-ZNF568 ANTIBODY PRODUCED IN RABBIT (C15-1450-794)
Price: $977.14List Price: $1,085.71Immunogen zinc finger protein 568 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA052061-100ULAnti-ZNF568 antibody produced in rabbit (C15-1460-892)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 568 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
