-
HPA021197-100UL
Anti-ZNF614 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 614 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA052422-100UL
Anti-ZNF615 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 615 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA062639-100UL
Anti-ZNF616 antibody produced in rabbit (C15-1464-137)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 616 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA071539-100UL
Anti-ZNF616 antibody produced in rabbit (C15-1466-062)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 616 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA023116-100UL
Anti-ZNF618 antibody produced in rabbit (C15-1450-259)
Price: $879.43List Price: $977.14Immunogen zinc finger protein 618 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA061732-100UL
Anti-ZNF618 antibody produced in rabbit (C15-1463-894)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 618 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA045094-100UL
Anti-ZNF619 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 619 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA031452-100UL
Anti-ZNF620 antibody produced in rabbit (C15-1453-126)
Price: $889.20List Price: $988.00Immunogen zinc finger protein 620 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA059383-100UL
Anti-ZNF620 antibody produced in rabbit (C15-1463-241)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 620 Sequence EKEGLTPKDHVSKETESFRLMVGGLPGNVSQHLDFGSSLEQPQGHWIIKTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA065518-100UL
Anti-ZNF621 antibody produced in rabbit (C15-1464-901)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 621 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA071440-100UL
Anti-ZNF621 antibody produced in rabbit (C15-1466-041)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 621 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA036514-100UL
Anti-ZNF622 antibody produced in rabbit (C15-1454-398)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 622 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the