-
HPA068130-100UL
Anti-ZNF630 antibody produced in rabbit (C15-1465-444)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 630 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA036784-100UL
Anti-ZNF638 antibody produced in rabbit (C15-1454-548)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 638 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA057395-100UL
Anti-ZNF638 antibody produced in rabbit (C15-1462-649)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 638 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA049023-100UL
Anti-ZNF639 antibody produced in rabbit (C15-1459-792)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 639 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA052163-100UL
Anti-ZNF639 antibody produced in rabbit (C15-1460-928)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 639 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA035189-100UL
Anti-ZNF641 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 641 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA057795-100UL
Anti-ZNF644 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 644 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA042364-100UL
Anti-ZNF646 antibody produced in rabbit (C15-1457-173)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 646 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA066468-100UL
Anti-ZNF646 antibody produced in rabbit (C15-1465-082)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 646 Sequence YQCSLCPRKYPNLMALRNHVRVHCKAARRSADIGAEGAPSHLKVELPPDPVEAEAAPHTDQDHVCKHEEEATDITPAADKTAAHICSICGLLFEDAE Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA053897-100UL
Anti-ZNF648 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 648 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA026541-100UL
Anti-ZNF649 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 649 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA044408-100UL
Anti-ZNF652 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 652 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported