Skip to main content

Immunomodulating drugs

Compare
  
  • anti-znf653 antibody produced in rabbit (c15-1450-466)
    Add to Cart The item has been added
    HPA023631-100UL

    Anti-ZNF653 antibody produced in rabbit (C15-1450-466)

    Price: $879.43
    List Price: $977.14
    Immunogen zinc finger protein 653 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA023631-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1450-466
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1450-466
    Description
    Immunogen zinc finger protein 653 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf653 antibody produced in rabbit (c15-1450-470)
    Add to Cart The item has been added
    HPA023635-100UL

    Anti-ZNF653 antibody produced in rabbit (C15-1450-470)

    Price: $879.43
    List Price: $977.14
    Immunogen zinc finger protein 653 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA023635-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1450-470
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1450-470
    Description
    Immunogen zinc finger protein 653 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf654 antibody produced in rabbit (c15-1454-215)
    Add to Cart The item has been added
    HPA036172-100UL

    Anti-ZNF654 antibody produced in rabbit (C15-1454-215)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 654 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA036172-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1454-215
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1454-215
    Description
    Immunogen zinc finger protein 654 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf654 antibody produced in rabbit (c15-1454-216)
    Add to Cart The item has been added
    HPA036173-100UL

    Anti-ZNF654 antibody produced in rabbit (C15-1454-216)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 654 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA036173-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1454-216
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1454-216
    Description
    Immunogen zinc finger protein 654 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
  • anti-znf654 antibody produced in rabbit (c15-1467-116)
    Add to Cart The item has been added
    HPA077939-100UL

    Anti-ZNF654 antibody produced in rabbit (C15-1467-116)

    Price: $928.29
    List Price: $1,031.43
    Immunogen Recombinant protein corresponding to zinc finger protein 654 Sequence CQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRTFQAQCSFPECHELFEDLPLLYEHEA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated
    Hide Expand
    SKUHPA077939-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1467-116
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1467-116
    Description
    Immunogen Recombinant protein corresponding to zinc finger protein 654 Sequence CQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRTFQAQCSFPECHELFEDLPLLYEHEA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated
  • anti-znf655 antibody produced in rabbit (c15-1452-310)
    Add to Cart The item has been added
    HPA029534-100UL

    Anti-ZNF655 antibody produced in rabbit (C15-1452-310)

    Price: $879.43
    List Price: $977.14
    Immunogen zinc finger protein 655 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA029534-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1452-310
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1452-310
    Description
    Immunogen zinc finger protein 655 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf655 antibody produced in rabbit (c15-1460-400)
    Add to Cart The item has been added
    HPA050750-100UL

    Anti-ZNF655 antibody produced in rabbit (C15-1460-400)

    Price: $967.37
    List Price: $1,074.86
    Immunogen zinc finger protein 655 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA050750-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1460-400
    Pack Size 100 UL
    Price:
    Price: $967.37
    List Price: $1,074.86
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1460-400
    Description
    Immunogen zinc finger protein 655 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
  • anti-znf658 antibody produced in rabbit (c15-1459-315)
    Add to Cart The item has been added
    HPA047730-100UL

    Anti-ZNF658 antibody produced in rabbit (C15-1459-315)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 658 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA047730-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1459-315
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1459-315
    Description
    Immunogen zinc finger protein 658 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf658 antibody produced in rabbit (c15-1459-676)
    Add to Cart The item has been added
    HPA048668-100UL

    Anti-ZNF658 antibody produced in rabbit (C15-1459-676)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 658 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA048668-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1459-676
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1459-676
    Description
    Immunogen zinc finger protein 658 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf660 antibody produced in rabbit
    Add to Cart The item has been added
    HPA029705-100UL

    Anti-ZNF660 antibody produced in rabbit

    Price: $879.43
    List Price: $977.14
    Immunogen zinc finger protein 660 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA029705-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1452-378
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1452-378
    Description
    Immunogen zinc finger protein 660 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf662 antibody produced in rabbit (c15-1455-588)
    Add to Cart The item has been added
    HPA039116-100UL

    Anti-ZNF662 antibody produced in rabbit (C15-1455-588)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 662 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA039116-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1455-588
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1455-588
    Description
    Immunogen zinc finger protein 662 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
  • anti-znf662 antibody produced in rabbit (c15-1456-166)
    Add to Cart The item has been added
    HPA040377-100UL

    Anti-ZNF662 antibody produced in rabbit (C15-1456-166)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 662 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA040377-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1456-166
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1456-166
    Description
    Immunogen zinc finger protein 662 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Lab - Point of Care

Lab Equipment & Accessories

Chemicals, Stains and Reagents

Medical Equipment

!