-
HPA062792-100UL
Anti-ZNF692 antibody produced in rabbit (C15-1464-193)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 692 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA024743-100UL
Anti-ZNF695 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene ZNF695 (zinc finger protein 695) is mapped to human chromosome 1q. The gene encodes many splice variants. -
HPA057855-100UL
Anti-ZNF696 antibody produced in rabbit (C15-1462-771)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 696 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA072473-100UL
Anti-ZNF696 antibody produced in rabbit (C15-1466-219)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 696 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA049933-100UL
Anti-ZNF697 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 697 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA058287-100UL
Anti-ZNF699 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 699 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA018821-100UL
Anti-ZNF70 antibody produced in rabbit
Price: $879.43List Price: $977.14The protein zinc finger protein-70 (ZNF70) belongs to Krüppel-type C2H2 zinc finger family. It contains a Krüppel-associated box (KRAB) domain. -
HPA005532-100UL
Anti-ZNF701 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 701 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA023930-100UL
Anti-ZNF703 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 703 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA024285-100UL
Anti-ZNF704 antibody produced in rabbit (C15-1450-704)
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 704 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA024302-100UL
Anti-ZNF704 antibody produced in rabbit (C15-1450-715)
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 704 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
AV32987-100UL
Anti-ZNF706 antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ZNF706 Sequence Synthetic peptide located within the following region: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPD Physical form Purified antibody supplied in 1x PBS