Immunomodulating drugs

The gene ZNHIT1 (zinc finger HIT domain-containing gene) is mapped to human chromosome 7q22.1.

Immunogen Synthetic peptide directed towards the N terminal region of human ZNHIT3 Application Anti-ZNHIT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen zinc finger, HIT-type containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen zinc finger HIT-type containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

The gene has been mapped to human chromosome 1p22.3.

Immunogen zinc ribbon domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to zinc ribbon domain containing 1 Sequence GTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen zinc and ring finger 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to zinc and ring finger 2 Sequence NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Tight junctions are complexes of proteins that create intercellular boundaries between the plasma membrane domains of epithelial and endothelial cells. Many of the tight junction-associated proteins are members of the membrane associated guanylate

Tight junctions are complexes of proteins that create intercellular boundaries between the plasma membrane domains of epithelial and endothelial cells. Many of the tight junction-associated proteins are members of the membrane associated guanylate

ZP2 (zona pellucida glycoprotein 2) is a part of a translucent matrix called zona pellucida (ZP), which forms the outer layer of oocyte. It forms heterodimers with ZP3, which are cross-linked by ZP1.