General description
Doublecortin and CaM kinase-like 2 (DCAMKL2) is expressed in the cell body and terminal regions of dendrites and axons. The gene encoding this protein is located on human chromosome 4q31.3.
Immunogen
DCAMKL2 (AAH32726, 348 a.a. ~ 438 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FRGLKISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE*
Biochem/physiol Actions
Doublecortin and CaM kinase-like 2 (DCAMKL2) has a role in stabilizing microtubules.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51201516
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0166614M1-100UG
- Temperature Control Device:
- Yes