General description
This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. (provided by RefSeq)
Immunogen
HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
Application
Monoclonal Anti-HHIP antibody produced in mouse has been used in immnohistochemistry.
Biochem/physiol Actions
The gene encoding HHIP (hedgehog interacting protein) is located on human chromosome 4, and encodes for a protein belonging to the hedgehog-interacting protein (HHIP) family. Hedgehog (HH) proteins are evolutionarily conserved proteins, and are important morphogens for a vast range of developmental processes, like regulation of left-right asymmetry and anteroposterior patterns of limbs during embryonic development. HH signals are regulated by numerous cell-surface receptors. HHIP encoded by this gene is highly conserved and interacts with all the three HH family members namely SHH (sonic hh), IHH (indian hh) and DHH (desert hh). It is also a vertebrate-specific inhibitor of HH signaling. Single nucleotide polymorphisms (SNPs) in HHIP gene is associated with increase in the risk of chronic obstructive pulmonary disease (COPD).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51322302
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0064399M1-100UG
- Temperature Control Device:
- Yes
