General description
Neuronal differentiation 1 (NeuroD1) belongs to the family of a basic helix-loop-helix transcription factor. The NEUROD1 gene is localized on human chromosome 2q31.3 and is expressed in developing neurons.
Immunogen
NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
Biochem/physiol Actions
Neuronal differentiation 1 (NeuroD1) may mediate the genesis of functional neurons from glial cells. Its higher expression favors neural differentiation in elder rats. NeuroD1 may be crucial for reversing functional impairment by favoring axonal regeneration in nerve injury. Various mutations in NEUROD1 reported have direct implications in the pathophysiology of early-onset diabetes, retinal dystrophy, nonsyndromic retinitis pigmentosa, and neurological abnormalities.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51143500
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0004760M1-100UG
- Temperature Control Device:
- Yes
