General description
Y-box binding protein 1 (YBX1) gene codes for Y-box protein 1 (YB-1) that has 324 amino acid residues, 8 exons and 7 introns. It is a member of the family of multifunctional DNA/RNA binding proteins. It is mainly present in the cytosol. YBX1 gene is mapped to human chromosome 1p34.
Immunogen
YBX1 (NP_004550, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA
Biochem/physiol Actions
Y-box binding protein 1 (YBX1) participates in pre-mRNA splicing, transcriptional regulation and mRNA translation and stability. It is also involved in DNA repair and environmental stress responses and chromatin remodeling.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51172437
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0004904M1-100UG
- Temperature Control Device:
- Yes
