General description
Recombinant protein fragment of Human SLC18A1with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Blocking agent and positive assay control using corresponding antibodies.
Linkage
Corresponding Antibodies HPA006877
Physical form
Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
recombinant: expressed in E. coli. Quality Level: 100. tag: His tagged. Assay: >. 80% (SDS-PAGE). form: buffered aqueous solution. mol wt: predicted mol wt 27 . kDa. purified by: immobilized metal affinity chromatography (IMAC). concentration: ≥. 0.5 . mg/mL. immunogen sequence: PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEI. Ensembl | human accession no.: ENSG00000036565. UniProt accession no.: P54219. shipped in: wet ice. storage temp.: −. 20°C. Gene Information: human ... SLC18A1(6570). Storage Class Code: 10 - Combustible liquids. WGK: WGK 2. Flash Point(F): Not applicable. Flash Point(C): Not applicable.- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- APREST70122-100UL