A00002-2,Antibodies,100ug/vial

Polyclonal antibody for TNF ALPHA/Tnf detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Mouse. TNF ALPHA/Tnf information: Molecular Weight: 25896 MW; Subcellular Localization: Cell membrane; Single-pass type II membrane protein. Background: TNFalpha(Tumor Necrosis Factor alpha) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. And this cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Moreover, this cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. Attributes: sku : A00002-2 name : Anti-TNF alpha Picoband™ Antibody gene_name : Tnf clonality : Polyclonal concentration : Add 0.2ml of distilled water will yield a concentration of 500ug/ml. contents : Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. size : 100ug/vial uniprot_id : P06804 host : Rabbit immunogen : A synthetic peptide corresponding to a sequence at the C-terminus of mouse TNF alpha (202-235aa FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL), different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids. form : Lyophilized purification : Immunogen affinity purified. storage : At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing. cross_reactivity : No cross reactivity with other proteins. isotype : N/A reconstitution : Add 0.2ml of distilled water will yield a concentration of 500ug/ml. application_details : Western blot, 0.1-0.5μg/ml, Mouse applications : WB reactivity : Mouse research_category : Atherosclerosis, Cancer, Cardiovascular, Cytokines, Growth Factors, Growth Factors/Hormones, Immunology, Innate Immunity, Metabolism, Signal Transduction, Tnf Superfamily, Vascular Inflammation synonyms : Tumor necrosis factor;Cachectin;TNF-alpha;Tumor necrosis factor ligand superfamily member 2;TNF-a;Tumor necrosis factor, membrane form;N-terminal fragment;NTF;Intracellular domain 1;ICD1;Intracellular domain 2;ICD2;C-domain 1;C-domain 2;Tumor necrosis factor, soluble form;Tnf;Tnfa, Tnfsf2; gene_full_name : Tumor necrosis factor molecular_weight : 25896 MW protein_function : Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. subcellular_localization : Cell membrane; Single-pass type II membrane protein. protein_name : Tumor necrosis factor recommended_detection_systems : Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.