Polyclonal antibody for Bcl-2/BCL2 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. Bcl-2/BCL2 information: Molecular Weight: 26266 MW; Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein . Nucleus membrane ; Single-pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein ; Tissue Specificity: Expressed in a variety of tissues. Background: Immunoreactive BCL2 protein in the neoplastic cells of almost all follicular lymphomas whereas no BCL2 protein was detected in follicles affected by nonneoplastic processes or in normal lymphoid tissue. Every tumor with molecular-genetic evidence of t(14;18) translocation expressed detectable levels of BCL2 protein, regardless of whether the breakpoint was located in or at a distance from the BCL2 gene. Overexpression of BCL2 blocks the apoptotic death of a pro-B-lymphocyte cell line. Attributes: sku : A00040-1 name : Anti-Bcl-2/BCL2 Picoband™ Antibody gene_name : BCL2 clonality : Polyclonal concentration : Add 0.2ml of distilled water will yield a concentration of 500ug/ml. contents : Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. size : 100ug/vial uniprot_id : P10415 host : Rabbit immunogen : A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences. form : Lyophilized purification : Immunogen affinity purified. storage : At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing. cross_reactivity : No cross reactivity with other proteins. reconstitution : Add 0.2ml of distilled water will yield a concentration of 500ug/ml. application_details : Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry(Frozen Section), 0.5-1μg/ml, Human Immunohistochemistry(Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Immunocytochemistry, 0.5-1μg/ml, Human Flow Cytometry, 1-3ug/1x10 6 cells, Human applications : Flow Cytometry, IHC, ICC, WB reactivity : Human, Mouse, Rat research_category : Apoptosis, Apoptotic Markers, Cancer, Cancer Metabolism, Cell Biology, Cell Death, Hypoxia, Intracellular, Invasion/Microenvironment, Metabolism, Metabolism Processes, Mitochondrial, Mitochondrial Markers, Mitochondrial Metabolism, Oncoproteins, Oncoproteins/Suppressors, Pathways And Processes, Response To Hypoxia, Signal Transduction, Tumor Biomarkers synonyms : Apoptosis regulator Bcl-2;BCL2; gene_full_name : Apoptosis regulator Bcl-2 molecular_weight : 26266 MW protein_function : Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). . subcellular_localization : Mitochondrion outer membrane ; Single-pass membrane protein . Nucleus membrane ; Single-pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein . tissue_specificity : Expressed in a variety of tissues. recommended_detection_systems : Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Shipping Information:

Dry Ice Surcharge & Ice Pack Shipments: $40

More Information: https://cenmed.com/shipping-returns