Immunogen

Synthetic peptide directed towards the C terminal region of human ABCD4

Biochem/physiol Actions

ABCD4 belongs to the ATP-binding cassette (ABC) transporters superfamily and is involved in transport of molecules across extra- and intra-cellular membranes. The ATPase activity of ABCD4 may be involved in the metabolism of vitamin B12.

Sequence

Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.