General description
The gene ABHD13 (α/β hydrolase domain-containing protein 13) is mapped to human chromosome 13q33.3.
Immunogen
Synthetic peptide directed towards the N terminal region of human ABHD13
Application
Anti-ABHD13 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
The α/β hydrolase fold domain (ABHD) family proteins are suggested to be involved in lipid synthesis and degradation. Copy number variations in ABHD13 are detected in humans suffering from rolandic epilepsies.
Sequence
Synthetic peptide located within the following region: SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51313406
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV50137-100UL