General description
ACAT2 is an acyl-coenzyme A cholesterol acyltransferase that regulates the esterification of cholesterol in cells. ACAT2 has been recommended as a treatment target for hypercholesterolemia and atherosclerosis. It has also been implicated in the inhibition of apoB secretion in liver cells.
Rabbit Anti-ACAT2 antibody recognizes bovine, human, mouse, and rat ACAT2.
The previously assigned protein identifier Q16146 has been merged into Q9BWD1. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the middle region of human ACAT2
Application
Rabbit Anti-ACAT2 (AB2) antibody can be used for western blot applications at a concentration of 2 μg/ml. It can also be used for IHC applications at a concentration of 4-8 μg/ml using paraffin-embedded tissues.
Biochem/physiol Actions
Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
Sequence
Synthetic peptide located within the following region: VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV32791-100UL