Immunogen
Synthetic peptide directed towards the C terminal region of human AGBL5
Application
Anti-AGBL5 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Biochem/physiol Actions
AGBL5 (ATP/GTP binding protein-like 5) gene encodes a 886 amino acid containing protein that belongs to peptidase M14 family and is predominantly expressed in brain. AGBL5 possesses glutamylase activity and is involved in the metabolism of the polyglutamate side-chains of tubulin. It facilitates the removal of α and γ linked glutamates from tubulin.
Sequence
Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201651
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV53752-100UL