Immunogen

Synthetic peptide directed towards the N terminal region of human AMT

Application

Anti-AMT antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

AMT gene encodes an enzyme aminomethyltransferase (T-protein), localized on to subband 3p21.2-p21.1, that is the critical component of the glycine cleavage system. T-protein facilitates the degradation of glycine to produce ammonia and 5,10-methylenetetrahydrofolate. Mutation in the AMT gene leads to typical or atypical nonketotic hyperglycinemia (NKH).

Sequence

Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.