General description

Angpt2 binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. It can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.

Immunogen

Synthetic peptide directed towards the middle region of Mouse Angpt2

Sequence

Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.